PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn190581
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family LBD
Protein Properties Length: 214aa    MW: 23774.8 Da    PI: 8.7359
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn190581genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601439e-45131121100
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 +CaaCk+l rkC+++Cv+apyfp +qp+kfanvhk+FGasnv+kll++l++++reda++sl+yeA++r+rdPvyG+vgvi+ lq+ql+ql+ +l ++k+
  Achn190581  13 PCAACKFLWRKCQPECVFAPYFPPDQPQKFANVHKVFGASNVTKLLNELHPHQREDAVNSLAYEADMRLRDPVYGCVGVISLLQHQLRQLQMDLTYAKS 111
                 7*********************************************************************************************99998 PP

      DUF260 100 e 100
                 e
  Achn190581 112 E 112
                 7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.63412113IPR004883Lateral organ boundaries, LOB
PfamPF031951.2E-4313110IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 214 aa     Download sequence    Send to blast
MASSSSSSLT NSPCAACKFL WRKCQPECVF APYFPPDQPQ KFANVHKVFG ASNVTKLLNE  60
LHPHQREDAV NSLAYEADMR LRDPVYGCVG VISLLQHQLR QLQMDLTYAK SELSKYQNHG  120
LLAAAAAAAT IHHHNHQINL IGGMNLSSRP DQHHYHPHHQ QQLMRRRSLD VANNYDASNS  180
SLLVAAGTMN AQFQHQQPRA AAGDDRRTPI HPS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002266137.11e-89PREDICTED: LOB domain-containing protein 6
RefseqXP_010646844.11e-89PREDICTED: LOB domain-containing protein 6
RefseqXP_010646845.11e-89PREDICTED: LOB domain-containing protein 6
RefseqXP_010646846.11e-89PREDICTED: LOB domain-containing protein 6
SwissprotO044792e-79LBD6_ARATH; LOB domain-containing protein 6
TrEMBLD7SSJ31e-89D7SSJ3_VITVI; Putative uncharacterized protein
STRINGVIT_00s0340g00090.t014e-89(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65620.43e-74LBD family protein